PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG344500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 347aa    MW: 36206.4 Da    PI: 7.8314
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG344500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-17170224256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Pavir.2NG344500.1.p 170 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 224
                          788899***********************************************98 PP

2HD-ZIP_I/II126.51.2e-40170260192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq+++LEesF+e+ +L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +
  Pavir.2NG344500.1.p 170 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-A 258
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Pavir.2NG344500.1.p 259 LK 260
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-18155227IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-18155220IPR009057Homeodomain-like
PROSITE profilePS5007116.989166226IPR001356Homeobox domain
SMARTSM003891.0E-15168230IPR001356Homeobox domain
CDDcd000861.53E-15170227No hitNo description
PfamPF000464.0E-15170224IPR001356Homeobox domain
PROSITE patternPS000270201224IPR017970Homeobox, conserved site
PfamPF021831.3E-10226260IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-24226269IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MELGLSLGET MADAGRDLVL GLGMGAGARR DGEAEPGRRE LEFGARRCGR RPSPEPAVRL  60
TLLPGLVPGL GLPWPPPSEA TRHLEASTRG FDVNRAPSLS AAGAAAEDDE ERDDAGAAGA  120
AAASSSPNNS AGSFPTDFSA HGQTGPGPSG GGGDRAGSRA SDEDDGGSAR KKLRLSKEQS  180
AFLEESFKEH ATLNPKQKLA LAKQLNLRPR QVEVWFQNRR ARTKLKQTEV DCEYLKRCCE  240
TLTEENRRLQ KELAELRALK TVHPFYMHLP ATTLSMCPSC ERVASTSAPA AAAPAQAASS  300
SPSPAGGGGI AAAPPEQRPS SFAALFSSPL SRPLAAQPQP QAPASS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218226RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.239801e-146root
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364470.0BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
GenBankKJ7269110.0KJ726911.1 Zea mays clone pUT3456 HB transcription factor (HB11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956965.11e-153PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ67UE21e-142HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLK3ZUP81e-156K3ZUP8_SETIT; Uncharacterized protein
STRINGSi030329m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-60homeobox from Arabidopsis thaliana